Catalog / single peptides / Sermorelin
Lyophilized Sterile Vial Tested: 99.4%
Sermorelin Acetate (GHRH 1-29)
Current Lot: MV-2026-SER10-02
High-Purity Lyophilized Peptide

Sermorelin Acetate (GHRH 1-29)

10mg / 5mL Lyophilized HPLC Purity: 99.4% Target: ≥ 99.0%

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the amino-terminal segment of naturally occurring growth hormone-releasing hormone.

Wholesale Commercial Pricing
Verified Provider Portal Required
• No consumer checkout • Tiered volume schedules • Certificate included with shipment
Formula C149H246N44O42
Molecular Weight 3357.88 g/mol
CAS Registry # 86168-78-7
Peptide Sequence / Structure YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Current Lot Verification

Lot #MV-2026-SER10-02 Analytical Results

Independent laboratory testing panel for active distribution batch.

Historical Lot Archive →
Analysis Category Reported Result Analytical Method Verification Status
Purity (RP-HPLC) 99.4% RP-HPLC Conforms
Identity (LC-MS) 3358.0 Da ESI-MS Conforms
Net Content 10.05 mg UV Quantitative Conforms
Endotoxin < 0.05 EU/mg LAL Kinetic Conforms

Biological Mechanism of Action

Stimulates endogenous pulsatile secretion of growth hormone by binding GHRH receptors on anterior pituitary somatotropic cells.

Research Focus Areas: GHRH Analogue Pulsatile Somatotrope Axis Pituitary Regulation

Scientific Literature Cross-Reference

Explore primary peer-reviewed papers, PubMed indexes, and pharmacology data for Sermorelin.