Lyophilized Sterile Vial
Tested: 99.4%
Current Lot: MV-2026-SER10-02
High-Purity Lyophilized Peptide
Sermorelin Acetate (GHRH 1-29)
10mg / 5mL Lyophilized • HPLC Purity: 99.4% • Target: ≥ 99.0%
Sermorelin is a synthetic 29-amino-acid peptide corresponding to the amino-terminal segment of naturally occurring growth hormone-releasing hormone.
Wholesale Commercial Pricing
Verified Provider Portal Required
• No consumer checkout • Tiered volume schedules • Certificate included with shipment
Formula C149H246N44O42
Molecular Weight 3357.88 g/mol
CAS Registry # 86168-78-7
Peptide Sequence / Structure YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Current Lot Verification
Historical Lot Archive → Lot #MV-2026-SER10-02 Analytical Results
Independent laboratory testing panel for active distribution batch.
| Analysis Category | Reported Result | Analytical Method | Verification Status |
|---|---|---|---|
| Purity (RP-HPLC) | 99.4% | RP-HPLC | Conforms |
| Identity (LC-MS) | 3358.0 Da | ESI-MS | Conforms |
| Net Content | 10.05 mg | UV Quantitative | Conforms |
| Endotoxin | < 0.05 EU/mg | LAL Kinetic | Conforms |
Biological Mechanism of Action
Stimulates endogenous pulsatile secretion of growth hormone by binding GHRH receptors on anterior pituitary somatotropic cells.
Research Focus Areas: GHRH Analogue Pulsatile Somatotrope Axis Pituitary Regulation
Scientific Literature Cross-Reference
Explore primary peer-reviewed papers, PubMed indexes, and pharmacology data for Sermorelin.